ABflo[R] 647 Rabbit anti-Human CD99 monoclonal antibody
Produktgrößen
10 tests
£ POA
A25832-10TESTS
100 tests
£229,00
A25832-100TESTS
200 tests
£360,00
A25832-200TESTS
500 tests
£622,00
A25832-500TESTS
Über dieses Produkt
- SKU:
- A25832
- Zusätzliche Namen:
- HBA71|MIC2|MIC2X|MIC2Y|MSK5X
- Anwendung:
- Flow Cytometry, Immunocytochemistry, Immunofluorescence
- Klonalität:
- Monoclonal
- Konjugat:
- ABflo® 647
- Weitere Details:
- The protein encoded by this gene is a cell surface glycoprotein involved in leukocyte migration, T-cell adhesion, ganglioside GM1 and transmembrane protein transport, and T-cell death by a caspase-independent pathway. In addition, the encoded protein may have the ability to rearrange the actin cytoskeleton and may also act as an oncosuppressor in osteosarcoma. This gene is found in the pseudoautosomal region of chromosomes X and Y and escapes X-chromosome inactivation. There is a related pseudogene located immediately adjacent to this locus.
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 19kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human
- Sequenz:
- GGFDLSDALPDNENKKPTAIPKKPSAGDDFDLGDAVVDGENDDPRPPNPPKPMPNPNPNHPSSSGSFSDADLADGVSGGEGKGGSDGGGSHRKEGEEADA
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- 2-8[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:A25832