ABflo[R] 594 Rabbit anti-Mouse CD252/OX40L monoclonal antibody
Produktgrößen
10 tests
£ POA
A25747-10TESTS
100 tests
£229,00
A25747-100TESTS
200 tests
£360,00
A25747-200TESTS
500 tests
£622,00
A25747-500TESTS
Über dieses Produkt
- SKU:
- A25747
- Zusätzliche Namen:
- Ath-1|Ath1|CD134L|gp34|OX-40L|Ox40l|Tnlg2b|TXGP1|Txgp1l
- Anwendung:
- Flow Cytometry, Immunocytochemistry, Immunofluorescence
- Klonalität:
- Monoclonal
- Konjugat:
- ABflo® 647
- Weitere Details:
- Enables tumor necrosis factor receptor binding activity. Involved in several processes, including T cell activation; regulation of gene expression; and regulation of lymphocyte activation. Acts upstream of or within cholesterol metabolic process; inflammatory response; and negative regulation of cytokine production. Predicted to be located in cell surface. Predicted to be active in extracellular space. Is expressed in sensory organ and skeleton. Used to study primary pulmonary hypertension and type 1 diabetes mellitus. Human ortholog(s) of this gene implicated in myocardial infarction. Orthologous to human TNFSF4 (TNF superfamily member 4).
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 22kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Mouse
- Sequenz:
- SSSPAKDPPIQRLRGAVTRCEDGQLFISSYKNEYQTMEVQNNSVVIKCDGLYIIYLKGSFFQEVKIDLHFREDHNPISIPMLNDGRRIVFTVVASLAFKDKVYLTVNAPDTLCEHLQINDGELIVVQLTPGYCAPEGSYHSTVNQVPL
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- 2-8[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:A25747