PE Rabbit anti-Mouse CD366/TIM-3/HAVCR2 monoclonal antibody
Produktgrößen
10 tests
£ POA
A25729-10TESTS
100 tests
£259,00
A25729-100TESTS
200 tests
£390,00
A25729-200TESTS
500 tests
£592,00
A25729-500TESTS
Über dieses Produkt
- SKU:
- A25729
- Zusätzliche Namen:
- TIM-3|Tim3|Timd3
- Anwendung:
- Flow Cytometry
- Klonalität:
- Monoclonal
- Weitere Details:
- Predicted to enable metal ion binding activity. Involved in several processes, including regulation of cytokine production; regulation of leukocyte activation; and toll-like receptor signaling pathway. Located in cell surface; early endosome; and immunological synapse. Is expressed in several structures, including dorsal aorta; gut; liver; lung; and reproductive system. Human ortholog(s) of this gene implicated in hepatocellular carcinoma and renal cell carcinoma. Orthologous to human HAVCR2 (hepatitis A virus cellular receptor 2).
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- Refer to figures
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Mouse
- Sequenz:
- RSLENAYVFEVGKNAYLPCSYTLSTPGALVPMCWGKGFCPWSQCTNELLRTDERNVTYQKSSRYQLKGDLNKGDVSLIIKNVTLDDHGTYCCRIQFPGLMNDKKLELKLDIKAAKVTPAQTAHGDSTTASPRTLTTERNGSETQTLVTLHNNNGTKISTWADEIKDSGETIR
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- 2-8[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:A25729