[KO Validated] MSH6 Rabbit monoclonal antibody
Produktgrößen
5 ul
£ POA
A25640-5UL
20 ul
£164,00
A25640-20UL
100 ug
£342,00
A25640-100UG
500 ul
£1532,00
A25640-500UL
1000 ul
£2704,00
A25640-1000UL
Über dieses Produkt
- SKU:
- A25640
- Zusätzliche Namen:
- GTBP|GTMBP|HNPCC5|HSAP|LYNCH5|MMRCS3|MSH-6|p160
- Anwendung:
- Detection/Quantitation, ELISA, IHC-Paraffin, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Western Blot
- Klonalität:
- Monoclonal
- Weitere Details:
- This gene encodes a member of the DNA mismatch repair MutS family. In E. coli, the MutS protein helps in the recognition of mismatched nucleotides prior to their repair. A highly conserved region of approximately 150 aa, called the Walker-A adenine nucleotide binding motif, exists in MutS homologs. The encoded protein heterodimerizes with MSH2 to form a mismatch recognition complex that functions as a bidirectional molecular switch that exchanges ADP and ATP as DNA mismatches are bound and dissociated. Mutations in this gene may be associated with hereditary nonpolyposis colon cancer, colorectal cancer, and endometrial cancer. Transcripts variants encoding different isoforms have been described.
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 180 kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human, Mouse, Rat
- Sequenz:
- MSRQSTLYSFFPKSPALSDANKASARASREGGRAAAAPGASPSPGGDAAWSEAGPGPRPLARSASPPKAKNLNGGLRRSVAPAAPTSCDFSPGDLVWAKM
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:A25640