NFYA Rabbit monoclonal antibody
Produktgrößen
5 ul
£ POA
A25583-5UL
20 ul
£164,00
A25583-20UL
100 ug
£342,00
A25583-100UG
500 ul
£1532,00
A25583-500UL
1000 ul
£2704,00
A25583-1000UL
Über dieses Produkt
- SKU:
- A25583
- Zusätzliche Namen:
- CBF-A|CBF-B|HAP2|NF-YA
- Anwendung:
- ChIP, ELISA, IHC-Paraffin, Immunoprecipitation, Western Blot
- Klonalität:
- Monoclonal
- Weitere Details:
- The protein encoded by this gene is one subunit of a trimeric complex, forming a highly conserved transcription factor that binds to CCAAT motifs in the promoter regions in a variety of genes. Subunit A associates with a tight dimer composed of the B and C subunits, resulting in a trimer that binds to DNA with high specificity and affinity. The sequence specific interactions of the complex are made by the A subunit, suggesting a role as the regulatory subunit. In addition, there is evidence of post-transcriptional regulation in this gene product, either by protein degradation or control of translation. Further regulation is represented by alternative splicing in the glutamine-rich activation domain, with clear tissue-specific preferences for the two isoforms.
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 37kDa/43kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human, Mouse, Rat
- Sequenz:
- EEPLYVNAKQYHRILKRRQARAKLEAEGKIPKERRKYLHESRHRHAMARKRGEGGRFFSPKEKDSPHMQDP
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:A25583