Cytokeratin 19 (KRT19) Rabbit monoclonal antibody
Produktgrößen
5 ul
£ POA
A25546-5UL
20 ul
£164,00
A25546-20UL
100 ug
£342,00
A25546-100UG
500 ul
£1532,00
A25546-500UL
1000 ul
£2704,00
A25546-1000UL
Über dieses Produkt
- SKU:
- A25546
- Zusätzliche Namen:
- CK19|K19|K1CS
- Anwendung:
- ELISA, Flow Cytometry, IHC-Paraffin, Immunocytochemistry, Immunofluorescence
- Klonalität:
- Monoclonal
- Weitere Details:
- The protein encoded by this gene is a member of the keratin family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. The type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains. Unlike its related family members, this smallest known acidic cytokeratin is not paired with a basic cytokeratin in epithelial cells. It is specifically expressed in the periderm, the transiently superficial layer that envelopes the developing epidermis. The type I cytokeratins are clustered in a region of chromosome 17q12-q21.
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- Refer to figures
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human, Mouse, Rat
- Sequenz:
- RTLQGLEIELQSQLSMKAALEDTLAETEARFGAQLAHIQALISGIEAQLGDVRADSERQNQEYQRLMDIKSRLEQEIATYRSLLEGQEDHYNNLSASKVL
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:A25546