IL33 Rabbit polyclonal antibody
Produktgrößen
20 ul
£152,00
A25253-20UL
100 ug
£336,00
A25253-100UG
500 ul
£1258,00
A25253-500UL
1000 ul
£2228,00
A25253-1000UL
Über dieses Produkt
- SKU:
- A25253
- Zusätzliche Namen:
- 9230117N10Rik|Il-33|Il1f11|NF-HEV
- Anwendung:
- ELISA, Western Blot
- Klonalität:
- Polyclonal
- Weitere Details:
- Enables cytokine activity and interleukin-33 receptor binding activity. Involved in several processes, including interleukin-33-mediated signaling pathway; microglial cell activation involved in immune response; and regulation of gene expression. Acts upstream of or within several processes, including negative regulation of macrophage proliferation; positive regulation of cellular defense response; and positive regulation of macromolecule metabolic process. Located in nucleus. Is expressed in several structures, including adrenal gland; alimentary system; genitourinary system; nervous system; and sensory organ. Used to study Alzheimer's disease. Human ortholog(s) of this gene implicated in candidiasis; inflammatory bowel disease; and peptic ulcer disease. Orthologous to human IL33 (interleukin 33).
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 20kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Mouse, Rat
- Sequenz:
- SIQGTSLLTQSPASLSTYNDQSVSFVLENGCYVINVDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKKLMVNMSPIKDTDIWLHANDKDYSVELQRGDVSPPEQAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLALVEEKDESCNNIMFKLSKI
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:A25253