ABflo[R] 594 Rabbit anti-Mouse CD321/JAM-1 monoclonal antibody
Produktgrößen
10 tests
£ POA
A25210-10TESTS
100 tests
£181,00
A25210-100TESTS
200 tests
£283,00
A25210-200TESTS
500 tests
£419,00
A25210-500TESTS
Über dieses Produkt
- SKU:
- A25210
- Zusätzliche Namen:
- 9130004G24|ESTM33|JAM|JAM-1|JAM-A|JAM-A/CD321|Jcam|Jcam1|Ly106
- Anwendung:
- Flow Cytometry
- Klonalität:
- Monoclonal
- Konjugat:
- ABflo® 647
- Weitere Details:
- Predicted to enable PDZ domain binding activity; integrin binding activity; and protein homodimerization activity. Involved in intestinal absorption; regulation of cytokine production; and regulation of membrane permeability. Acts upstream of or within cell adhesion and epithelial cell differentiation. Located in bicellular tight junction. Is expressed in several structures, including 4-8 cell stage embryo; alimentary system; respiratory system; sensory organ; and urinary system. Human ortholog(s) of this gene implicated in hypertension. Orthologous to human F11R (F11 receptor).
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 32kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Mouse
- Sequenz:
- KGSVYTAQSDVQVPENESIKLTCTYSGFSSPRVEWKFVQGSTTALVCYNSQITAPYADRVTFSSSGITFSSVTRKDNGEYTCMVSEEGGQNYGEVSIHLTVLVPPSKPTISVPSSVTIGNRAVLTCSEHDGSPPSEYSWFKDGISMLTADAKKTRAFMNSSFTIDPKSGDLIFDPVTAFDSGEYYCQAQNGYGTAMRSEAAHMDAVELNVGGIVAA
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- 2-8[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:A25210