Nectin-4/PVRL4 Rabbit monoclonal antibody
Produktgrößen
5 ul
£ POA
A25200-5UL
20 ul
£164,00
A25200-20UL
100 ul
£342,00
A25200-100UL
500 ul
£1532,00
A25200-500UL
1000 ul
£2704,00
A25200-1000UL
Über dieses Produkt
- SKU:
- A25200
- Zusätzliche Namen:
- EDSS1|LNIR|nectin-4|PRR4|PVRL4
- Anwendung:
- ELISA, Flow Cytometry
- Klonalität:
- Monoclonal
- Weitere Details:
- Nectin-4/ poliovirus Receptor-like 4 (PVRL4) is a type I transmembrane glycoprotein belonging to the immunoglobulin superfamily that promotes intercellular adhesion by acting as a major component of adhesion junctions. The extracellular domain of Nectin-4 consists of one Ig variable region (V) and two Ig constant regions (C), which mediate binding to measles virus and adjacent cells through trans-heterophile interactions with Nectin-1. Unlike other members of the connectin family, which are widely expressed in adult tissues, human Nectin-4 expression is largely limited to the blastoderm. Studies have shown that Nectin-4 is overexpressed in cells from a variety of human solid tumors, including pancreatic, breast, lung, and ovarian cancers. The expression pattern of Nectin-4 in normal tissues is limited, so NECTIN-4 can be used as a novel therapeutic target for various human tumors.
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 24kDa/55kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human
- Sequenz:
- GELETSDVVTVVLGQDAKLPCFYRGDSGEQVGQVAWARVDAGEGAQELALLHSKYGLHVSPAYEGRVEQPPPPRNPLDGSVLLRNAVQADEGEYECRVSTFPAGSFQARLRLRVL
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:A25200