ABflo[R] 647 Rabbit anti-Human/Monkey CD127/IL-7RA Alpha monoclonal antibody
Produktgrößen
10 tests
£ POA
A25162-10TESTS
100 tests
£324,00
A25162-100TESTS
200 tests
£509,00
A25162-200TESTS
500 tests
£782,00
A25162-500TESTS
Über dieses Produkt
- SKU:
- A25162
- Zusätzliche Namen:
- CD127|CD127/IL7R|CDW127|IL-7R-alpha|IL-7Ralpha|IL7RA|IL7Ralpha|ILRA|IMD104|lnc-IL7R|sIL-7R
- Anwendung:
- Flow Cytometry
- Klonalität:
- Monoclonal
- Konjugat:
- ABflo® 647
- Weitere Details:
- The protein encoded by this gene is a receptor for interleukin 7 (IL7). The function of this receptor requires the interleukin 2 receptor, gamma chain (IL2RG), which is a common gamma chain shared by the receptors of various cytokines, including interleukins 2, 4, 7, 9, and 15. This protein has been shown to play a critical role in V(D)J recombination during lymphocyte development. Defects in this gene may be associated with severe combined immunodeficiency (SCID). Alternatively spliced transcript variants have been found.
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 52kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human, Non-human Primate
- Sequenz:
- ESGYAQNGDLEDAELDDYSFSCYSQLEVNGSQHSLTCAFEDPDVNITNLEFEICGALVEVKCLNFRKLQEIYFIETKKFLLIGKSNICVKVGEKSLTCKKIDLTTIVKPEAPFDLSVVYREGANDFVVTFNTSHLQKKYVKVLMHDVAYRQEKDENKWTHVNLSSTKLTLLQRKLQPAAMYEIKVRSIPDHYFKGFWSEWSPSYYFRTPEINNSSG
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- 2-8[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:A25162