ABflo[R] 594 Rabbit anti-Mouse IL-13 monoclonal antibody
Produktgrößen
10 tests
£ POA
A25119-10TESTS
100 tests
£324,00
A25119-100TESTS
200 tests
£509,00
A25119-200TESTS
500 tests
£782,00
A25119-500TESTS
Über dieses Produkt
- SKU:
- A25119
- Zusätzliche Namen:
- Il-13
- Anwendung:
- Flow Cytometry
- Klonalität:
- Monoclonal
- Konjugat:
- ABflo® 647
- Weitere Details:
- Predicted to enable interleukin-13 receptor binding activity. Involved in positive regulation of cold-induced thermogenesis and positive regulation of macrophage activation. Acts upstream of or within cellular response to cytokine stimulus; inflammatory response; and positive regulation of immune effector process. Located in cytoplasm; external side of plasma membrane; and extracellular space. Is expressed in gut; liver; male reproductive gland or organ; and thymus. Used to study atopic dermatitis. Human ortholog(s) of this gene implicated in several diseases, including allergic disease (multiple); autoimmune disease (multiple); diffuse scleroderma; lung disease (multiple); and nose disease (multiple). Orthologous to human IL13 (interleukin 13).
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 14kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Mouse
- Sequenz:
- PGPVPRSVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- 2-8[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:A25119