ABflo[R] 594 Rabbit anti-Mouse CD28 monoclonal antibody
Produktgrößen
10 tests
£ POA
A25058-10TESTS
100 tests
£259,00
A25058-100TESTS
200 tests
£390,00
A25058-200TESTS
500 tests
£592,00
A25058-500TESTS
Über dieses Produkt
- SKU:
- A25058
- Zusätzliche Namen:
- Cd28
- Anwendung:
- Flow Cytometry
- Klonalität:
- Monoclonal
- Konjugat:
- ABflo® 647
- Weitere Details:
- Enables protein kinase binding activity. Acts upstream of or within several processes, including positive regulation of immune response; positive regulation of intracellular signal transduction; and regulation of lymphocyte activation. Located in external side of plasma membrane and immunological synapse. Human ortholog(s) of this gene implicated in multiple sclerosis and type 1 diabetes mellitus. Orthologous to human CD28 (CD28 molecule).
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 25kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Mouse
- Sequenz:
- NKILVKQSPLLVVDSNEVSLSCRYSYNLLAKEFRASLYKGVNSDVEVCVGNGNFTYQPQFRSNAEFNCDGDFDNETVTFRLWNLHVNHTDIYFCKIEFMYPPPYLDNERSNGTIIHIKEKHLCHTQSSPK
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- 2-8[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:A25058