Il15ra Rabbit polyclonal antibody
Produktgrößen
20 ul
£152,00
A25036-20UL
100 ul
£336,00
A25036-100UL
500 ul
£1258,00
A25036-500UL
1000 ul
£2228,00
A25036-1000UL
Über dieses Produkt
- SKU:
- A25036
- Zusätzliche Namen:
- IL-15RA|Il15ra
- Anwendung:
- ELISA, Western Blot
- Klonalität:
- Polyclonal
- Weitere Details:
- Predicted to enable interleukin-15 receptor activity and protein kinase binding activity. Acts upstream of or within positive regulation of natural killer cell differentiation. Located in cytoplasmic vesicle and plasma membrane. Is expressed in central nervous system; retina; retina inner nuclear layer; and retina outer nuclear layer. Orthologous to human IL15RA (interleukin 15 receptor subunit alpha).
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 28kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Mouse
- Sequenz:
- GTTCPPPVSIEHADIRVKNYSVNSRERYVCNSGFKRKAGTSTLIECVINKNTNVAHWTTPSLKCIRDPSLAHY
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:A25036