ABflo[R] 647 Rabbit anti-Mouse IgG1 monoclonal antibody
Produktgrößen
10 tests
£ POA
A24925-10TESTS
100 tests
£181,00
A24925-100TESTS
200 tests
£283,00
A24925-200TESTS
500 tests
£419,00
A24925-500TESTS
Über dieses Produkt
- SKU:
- A24925
- Zusätzliche Namen:
- IgG1
- Anwendung:
- Flow Cytometry
- Klonalität:
- Monoclonal
- Konjugat:
- ABflo® 647
- Weitere Details:
- Mouse IgG1 is a subtype of immunoglobulin G antibody that is produced by B cells in response to an antigen. It is the most abundant IgG subtype in the serum and plays a crucial role in the adaptive immune response. Mouse IgG1 is composed of two heavy chains and two light chains, and it is involved in opsonization, complement activation, and antibody-dependent cell-mediated cytotoxicity. It is also involved in the regulation of immune responses, including the activation of T cells and the inhibition of B cell activation. Mouse IgG1 is widely used in research and diagnostic applications, including ELISA, Western blotting, and immunohistochemistry. It is also used in therapeutic applications, such as immunotherapy and vaccine development.
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 36kda
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Mouse
- Sequenz:
- AKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPRDCGCKPCICTVPEVSSVFIFPPKPKDVLTITLTPKVTCVVVDISKDDPEVQFSWFVDDVEVHTAQTQPREEQFNSTFRSVSELPIMHQDWLNGKEFKCRVNSAAFPAPIEKTISKTKGRPKAPQVYTIPPPKEQMAKDKVSLTCMITDFFPEDITVEWQWNGQPAENYKNTQPIMNTNGSYFVYSKLNVQKSNWEAGNTFTCSVLHEGLHNHHTEKSLSHSPGK
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- 2-8[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Secondary Antibodies
- Datenblatt des Herstellers:A24925