Hsc70/HSPA8 Rabbit polyclonal antibody
Produktgrößen
20 ul
£152,00
A2487-20UL
100 ul
£336,00
A2487-100UL
500 ul
£1258,00
A2487-500UL
1000 ul
£2228,00
A2487-1000UL
Über dieses Produkt
- SKU:
- A2487
- Zusätzliche Namen:
- HEL-33|HEL-S-72p|HSC54|HSC70|Hsc70/HSPA8|HSC71|HSP71|HSP73|HSPA10|LAP-1|LAP1|NIP71
- Anwendung:
- ELISA, IHC-Paraffin, Immunocytochemistry, Immunofluorescence, Western Blot
- Klonalität:
- Polyclonal
- Weitere Details:
- This gene encodes a member of the heat shock protein 70 family, which contains both heat-inducible and constitutively expressed members. This protein belongs to the latter group, which are also referred to as heat-shock cognate proteins. It functions as a chaperone, and binds to nascent polypeptides to facilitate correct folding. It also functions as an ATPase in the disassembly of clathrin-coated vesicles during transport of membrane components through the cell. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 72kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human, Mouse, Non-human Primate, Rat
- Sequenz:
- LSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQSAG
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:A2487