ABflo[R] 594 Rabbit anti-Mouse CD124/IL-4RA Alpha monoclonal antibody
Produktgrößen
10 tests
£ POA
A24725-10TESTS
100 tests
£324,00
A24725-100TESTS
200 tests
£509,00
A24725-200TESTS
500 tests
£782,00
A24725-500TESTS
Über dieses Produkt
- SKU:
- A24725
- Zusätzliche Namen:
- CD124|Il4r
- Anwendung:
- Flow Cytometry
- Klonalität:
- Monoclonal
- Konjugat:
- ABflo® 647
- Weitere Details:
- Predicted to enable cytokine receptor activity. Involved in positive regulation of chemokine production; positive regulation of cold-induced thermogenesis; and positive regulation of macrophage activation. Acts upstream of or within several processes, including defense response to protozoan; negative regulation of T-helper 1 cell differentiation; and positive regulation of immune effector process. Predicted to be located in several cellular components, including centriolar satellite; extracellular space; and nucleoplasm. Predicted to be part of receptor complex. Is expressed in several structures, including adrenal medulla; early conceptus; hemolymphoid system; medulla oblongata basal plate mantle layer; and reproductive system. Used to study asthma. Human ortholog(s) of this gene implicated in several diseases, including acne; allergic conjunctivitis; autoimmune disease (multiple); human immunodeficiency virus infectious disease; and renal tuberculosis. Orthologous to human IL4R (interleukin 4 receptor).
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 87kda
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Mouse
- Sequenz:
- IKVLGEPTCFSDYIRTSTCEWFLDSAVDCSSQLCLHYRLMFFEFSENLTCIPRNSASTVCVCHMEMNRPVQSDRYQMELWAEHRQLWQGSFSPSGNVKPLAPDNLTLHTNVSDEWLLTWNNLYPSNNLLYKDLISMVNISREDNPAEFIVYNVTYKEPRLSFPINILMSGVYYTARVRVRSQILTGTWSEWSPSITWYNHFQLPLIQR
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- 2-8[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:A24725

