Human IgG4/Immunoglobulin heavy constant gamma 4 Rabbit polyclonal antibody
Produktgrößen
5 ul
£ POA
A24655-5UL
20 ul
£152,00
A24655-20UL
100 ul
£336,00
A24655-100UL
500 ul
£1258,00
A24655-500UL
1000 ul
£2228,00
A24655-1000UL
Über dieses Produkt
- SKU:
- A24655
- Zusätzliche Namen:
- Human IgG4/Immunoglobulin heavy constant gamma 4|Ig gamma-4 chain C region|IGHG4
- Anwendung:
- ELISA, Western Blot
- Klonalität:
- Polyclonal
- Weitere Details:
- Immunoglobulin G (IgG), is one of the most abundant protein in human serum with normal levels between 8-17 mg/ml in adult blood. IgG is important for our defence against microorganisms and the molecules are produced by B-lymphocytes as a part of our adaptive immune response. The IgG molecule has two separate functions; to bind to the pathogen that elicited the response and to recruit other cells and molecules to destroy the antigen. The variability of the IgG pool is generated by somatic recombination and the number of specificities in an individual at a given time point is estimated to be 1011 variants.
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 36kda
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human
- Sequenz:
- VHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPSCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQED
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:A24655