CDKN2A/p19ARF Rabbit monoclonal antibody
Produktgrößen
5 ul
£ POA
A24653-5UL
20 ul
£164,00
A24653-20UL
100 ul
£342,00
A24653-100UL
500 ul
£1532,00
A24653-500UL
1000 ul
£2704,00
A24653-1000UL
Über dieses Produkt
- SKU:
- A24653
- Zusätzliche Namen:
- Arf|ARF-INK4a|CDKN2A/p19ARF|INK4a-ARF|Ink4a/Arf|MTS1|p16|p16(INK4a)|p16INK4a|p19<ARF>|p19ARF|Pctr1
- Anwendung:
- ELISA, Immunocytochemistry, Immunofluorescence, Western Blot
- Klonalität:
- Monoclonal
- Weitere Details:
- Enables MDM2/MDM4 family protein binding activity; enzyme inhibitor activity; and protein N-terminus binding activity. Involved in several processes, including negative regulation of lymphocyte proliferation; positive regulation of apoptotic process; and regulation of transcription, DNA-templated. Acts upstream of or within several processes, including negative regulation of cellular protein metabolic process; negative regulation of mammary gland epithelial cell proliferation; and positive regulation of apoptotic process involved in mammary gland involution. Located in cytoplasm and granular component. Part of protein-containing complex. Is expressed in several structures, including bone marrow; central nervous system; dorsal root ganglion; eye; and testis. Human ortholog(s) of this gene implicated in several diseases, including breast cancer (multiple); carcinoma (multiple); hematologic cancer (multiple); melanoma (multiple); and nervous system cancer (multiple). Orthologous to human CDKN2A (cyclin dependent kinase inhibitor 2A).
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 21 kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Mouse
- Sequenz:
- MGRRFLVTVRIQRAGRPLQERVFLVKFVRSRRPRTASCALAFVNMLLRLERILRRGPHRNPGPGDDDGQRSRSSSSAQLRCRFELRGPHYLLPPGARRSA
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:A24653