ABflo[R] 594 Rabbit anti-Human CD158b/KIR2DL2/KIR2DL3 monoclonal antibody
Produktgrößen
10 tests
£ POA
A24576-10TESTS
100 tests
£259,00
A24576-100TESTS
200 tests
£390,00
A24576-200TESTS
500 tests
£592,00
A24576-500TESTS
Über dieses Produkt
- SKU:
- A24576
- Zusätzliche Namen:
- CD158b|CD158B2|GL183|killer cell immunoglobulin-like receptor 2DL3|KIR-023GB|KIR-K7b|KIR-K7c|KIR2DL3|KIR2DS5|KIRCL23|NKAT|NKAT2|NKAT2A|NKAT2B|p58
- Anwendung:
- Flow Cytometry, Immunocytochemistry, Immunofluorescence
- Klonalität:
- Monoclonal
- Konjugat:
- ABflo® 647
- Weitere Details:
- Killer cell immunoglobulin-like receptors (KIRs) are transmembrane glycoproteins expressed by natural killer cells and subsets of T cells. The KIR genes are polymorphic and highly homologous and they are found in a cluster on chromosome 19q13.4 within the 1 Mb leukocyte receptor complex (LRC). The gene content of the KIR gene cluster varies among haplotypes, although several 'framework' genes are found in all haplotypes (KIR3DL3, KIR3DP1, KIR3DL4, KIR3DL2). The KIR proteins are classified by the number of extracellular immunoglobulin domains (2D or 3D) and by whether they have a long (L) or short (S) cytoplasmic domain. KIR proteins with the long cytoplasmic domain transduce inhibitory signals upon ligand binding via an immune tyrosine-based inhibitory motif (ITIM), while KIR proteins with the short cytoplasmic domain lack the ITIM motif and instead associate with the TYRO protein tyrosine kinase binding protein to transduce activating signals. The ligands for several KIR proteins are subsets of HLA class I molecules; thus, KIR proteins are thought to play an important role in regulation of the immune response.
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- Refer to figures
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human
- Sequenz:
- HEGVHRKPSLLAHPGPLVKSEETVILQCWSDVRFQHFLLHREGKFKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHERRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVTGNPSNSWPSPTEPSSETGNPRHLH
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- 2-8[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:A24576