CD53 Rabbit polyclonal antibody
Produktgrößen
20 ul
£152,00
A24527-20UL
100 ul
£336,00
A24527-100UL
500 ul
£1258,00
A24527-500UL
1000 ul
£2228,00
A24527-1000UL
Über dieses Produkt
- SKU:
- A24527
- Zusätzliche Namen:
- CD53|Ox-44|Tspan25
- Anwendung:
- ELISA, Western Blot
- Klonalität:
- Polyclonal
- Weitere Details:
- Predicted to enable identical protein binding activity. Involved in positive regulation of myoblast fusion. Located in cell-cell junction and plasma membrane. Is expressed in several structures, including alimentary system; brain; genitourinary system; hemolymphoid system gland; and liver and biliary system. Orthologous to human CD53 (CD53 molecule).
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 35-45kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Mouse
- Sequenz:
- EQKLNTLVAEGLNDSIQHYHSDNSTMKAWDFIQTQLQCCGVNGSSDWTSGPPSSCPSGADVQGCYNKAKSWFHSN
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:A24527