CD74 Rabbit polyclonal antibody
Produktgrößen
20 ul
£152,00
A24487-20UL
100 ul
£336,00
A24487-100UL
500 ul
£1258,00
A24487-500UL
1000 ul
£2228,00
A24487-1000UL
Über dieses Produkt
- SKU:
- A24487
- Zusätzliche Namen:
- CD74|CLIP|DHLAG|HLADG|Ia-GAMMA|Ii
- Anwendung:
- ELISA, Western Blot
- Klonalität:
- Polyclonal
- Weitere Details:
- Enables MHC class II protein binding activity; cytokine receptor activity; and nitric-oxide synthase binding activity. Contributes to cytokine binding activity. Involved in several processes, including macrophage migration inhibitory factor signaling pathway; positive regulation of macromolecule metabolic process; and regulation of signal transduction. Acts upstream of or within several processes, including antigen processing and presentation of exogenous peptide antigen via MHC class II; regulation of T cell differentiation; and thymic T cell selection. Located in several cellular components, including Golgi apparatus; external side of plasma membrane; and multivesicular body. Part of MHC class II protein complex; NOS2-CD74 complex; and macrophage migration inhibitory factor receptor complex. Is expressed in lower jaw; lower jaw incisor; lower jaw molar; and thymus primordium. Orthologous to human CD74 (CD74 molecule).
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 34kda
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Mouse
- Sequenz:
- QQQGRLDKLTITSQNLQLESLRMKLPKSAKPVSQMRMATPLLMRPMSMDNMLLGPVKNVTKYGNMTQDHVMHLLTRSGPLEYPQLKGTFPENLKHLKNSMDGVNWKIFESWMKQWLLFEMSKNSLEEKKPTEAPPKEPLDMEDLSSGLGVTRQELGQVTL
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:A24487