PGHS-2 Rabbit polyclonal antibody
Produktgrößen
20 ul
£152,00
A24438-20UL
100 ug
£336,00
A24438-100UG
500 ul
£1258,00
A24438-500UL
1000 ul
£2228,00
A24438-1000UL
Über dieses Produkt
- SKU:
- A24438
- Zusätzliche Namen:
- COX-2|COX2|GRIPGHS|hCox-2|PGG/HS|PGHS-2|PHS-2
- Anwendung:
- Western Blot
- Klonalität:
- Polyclonal
- Weitere Details:
- Prostaglandin-endoperoxide synthase (PTGS), also known as cyclooxygenase, is the key enzyme in prostaglandin biosynthesis, and acts both as a dioxygenase and as a peroxidase. There are two isozymes of PTGS: a constitutive PTGS1 and an inducible PTGS2, which differ in their regulation of expression and tissue distribution. This gene encodes the inducible isozyme. It is regulated by specific stimulatory events, suggesting that it is responsible for the prostanoid biosynthesis involved in inflammation and mitogenesis.
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 70kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human
- Sequenz:
- GETMVEVGAPFSLKGLMGNVICSPAYWKPSTFGGEVGFQIINTASIQSLICNNVKGCPFTSFSVPDPELIKTVTINASSSRSGLDDINPTVLLKERSTEL
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:A24438