Mouse G-CSF Rabbit monoclonal antibody
Produktgrößen
5 ul
£ POA
A24423-5UL
20 ul
£164,00
A24423-20UL
100 ug
£342,00
A24423-100UG
500 ul
£1532,00
A24423-500UL
1000 ul
£2704,00
A24423-1000UL
Über dieses Produkt
- SKU:
- A24423
- Zusätzliche Namen:
- Csfg|G-CSF|MGI-IG|Mouse G-CSF
- Anwendung:
- ELISA, Western Blot
- Klonalität:
- Monoclonal
- Weitere Details:
- Enables granulocyte colony-stimulating factor receptor binding activity. Acts upstream of or within positive regulation of myeloid cell differentiation. Predicted to be located in endocytic vesicle lumen and extracellular region. Predicted to be active in extracellular space. Is expressed in several structures, including brain; dorsal aorta; liver; reproductive system; and yolk sac. Human ortholog(s) of this gene implicated in several diseases, including allergic cutaneous vasculitis; artery disease (multiple); ischemia (multiple); leukemia (multiple); and lung disease (multiple). Orthologous to human CSF3 (colony stimulating factor 3).
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 50-60kDa (Recombinant Protein)
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Mouse
- Sequenz:
- VPLVTVSALPPSLPLPRSFLLKSLEQVRKIQASGSVLLEQLCATYKLCHPEELVLLGHSLGIPKASLSGCSSQALQQTQCLSQLHSGLCLYQGLLQALSGISPALAPTLDLLQLDVANFATTIWQQMENLGVAPTVQPTQSAMPAFTSAFQRRAGGVLAISYLQGFLETARLALHHLA
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:A24423