ABflo[R] 488 Rabbit anti-Human Podoplanin monoclonal antibody
Produktgrößen
10 tests
£ POA
A24408-10TESTS
100 tests
£259,00
A24408-100TESTS
200 tests
£390,00
A24408-200TESTS
500 tests
£592,00
A24408-500TESTS
Über dieses Produkt
- SKU:
- A24408
- Zusätzliche Namen:
- AGGRUS|GP36|Gp38|GP40|HT1A-1|OTS8|PA2.26|PDPN|podoplanin|T1A|T1A-2|T1A2|TI1A
- Anwendung:
- Flow Cytometry
- Klonalität:
- Monoclonal
- Konjugat:
- ABflo® 488
- Weitere Details:
- This gene encodes a type-I integral membrane glycoprotein with diverse distribution in human tissues. The physiological function of this protein may be related to its mucin-type character. The homologous protein in other species has been described as a differentiation antigen and influenza-virus receptor. The specific function of this protein has not been determined but it has been proposed as a marker of lung injury. Alternatively spliced transcript variants encoding different isoforms have been identified.
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 12kDa/16kDa/18kDa/24kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human
- Sequenz:
- EGASTGQPEDDTETTGLEGGVAMPGAEDDVVTPGTSEDRYKSGLTTLVATSVNSVTGIRIEDLPTSESTVHAQEQSPSATASNVATSHSTEKVDGDTQTTVEK
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- 2-8[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:A24408
