Collagen II Rabbit polyclonal antibody
Produktgrößen
20 ul
£152,00
A24334-20UL
100 ul
£336,00
A24334-100UL
500 ul
£1258,00
A24334-500UL
1000 ul
£2228,00
A24334-1000UL
Über dieses Produkt
- SKU:
- A24334
- Zusätzliche Namen:
- ANFH|AOM|COL11A3|Collagen II|SEDC|STL1
- Anwendung:
- ELISA, Immunoprecipitation, Western Blot
- Klonalität:
- Polyclonal
- Weitere Details:
- This gene encodes the alpha-1 chain of type II collagen, a fibrillar collagen found in cartilage and the vitreous humor of the eye. Mutations in this gene are associated with achondrogenesis, chondrodysplasia, early onset familial osteoarthritis, SED congenita, Langer-Saldino achondrogenesis, Kniest dysplasia, Stickler syndrome type I, and spondyloepimetaphyseal dysplasia Strudwick type. In addition, defects in processing chondrocalcin, a calcium binding protein that is the C-propeptide of this collagen molecule, are also associated with chondrodysplasia. There are two transcripts identified for this gene.
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 36 kda
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human, Mouse, Rat
- Sequenz:
- PGPKGQKGEPGDIKDIVGPKGPPGPQGPAGEQGPRGDRGDKGEKGAPGPRGRDGEPGTPGNPGPPGPPGPPGPPGLGGNFAAQMAGGFDEKAGGAQLGVMQ
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C 0.09% sodium azide. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:A24334