ABflo[R] 647 Rabbit anti-Human CD303/BDCA-2 monoclonal antibody
Produktgrößen
10 tests
£ POA
A24312-10TESTS
100 tests
£324,00
A24312-100TESTS
200 tests
£509,00
A24312-200TESTS
500 tests
£782,00
A24312-500TESTS
Über dieses Produkt
- SKU:
- A24312
- Zusätzliche Namen:
- BDCA2|C-type lectin domain family 4 member C|CD303|CLEC4C|CLECSF11|CLECSF7|DLEC|HECL|PRO34150
- Anwendung:
- Flow Cytometry
- Klonalität:
- Monoclonal
- Konjugat:
- ABflo® 647
- Weitere Details:
- This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. The encoded type 2 transmembrane protein may play a role in dendritic cell function. Two transcript variants encoding distinct isoforms have been identified for this gene.
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- Refer to figures
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human
- Sequenz:
- NFMYSKTVKRLSKLREYQQYHPSLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVMGADLVVINTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVDQTPYNENVTFWHSGEPNNLDERCAIINFRSSEEWGWNDIHCHVPQKSICKMKKIYI
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- 2-8[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:A24312

