PE Rabbit anti-Human CD79b monoclonal antibody
Produktgrößen
10 tests
£ POA
A24251-10TESTS
100 tests
£259,00
A24251-100TESTS
200 tests
£390,00
A24251-200TESTS
500 tests
£592,00
A24251-500TESTS
Über dieses Produkt
- SKU:
- A24251
- Zusätzliche Namen:
- AGM6|B29|CD79B|CD79b molecule|IGB
- Anwendung:
- Flow Cytometry
- Klonalität:
- Monoclonal
- Konjugat:
- R-PE
- Weitere Details:
- The B lymphocyte antigen receptor is a multimeric complex that includes the antigen-specific component, surface immunoglobulin (Ig). Surface Ig non-covalently associates with two other proteins, Ig-alpha and Ig-beta, which are necessary for expression and function of the B-cell antigen receptor. This gene encodes the Ig-beta protein of the B-cell antigen component. Alternatively spliced transcript variants encoding different isoforms have been described.
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 14kDa/26kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human
- Sequenz:
- ARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKD
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- 2-8[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:A24251