ASC/TMS1 Rabbit monoclonal antibody
Produktgrößen
5 ul
£ POA
A24165-5UL
20 ul
£164,00
A24165-20UL
100 ul
£342,00
A24165-100UL
500 ul
£1532,00
A24165-500UL
1000 ul
£2704,00
A24165-1000UL
Über dieses Produkt
- SKU:
- A24165
- Zusätzliche Namen:
- 9130417A21Rik|Asc|ASC/TMS1|CARD5|masc|TMS-1|TNS1
- Anwendung:
- ELISA, IHC-Paraffin, Immunocytochemistry, Immunofluorescence, Western Blot
- Klonalität:
- Monoclonal
- Weitere Details:
- Enables identical protein binding activity and protein dimerization activity. Involved in several processes, including activation of cysteine-type endopeptidase activity; positive regulation of cytokine production; and regulation of defense response. Acts upstream of or within several processes, including defense response to Gram-positive bacterium; positive regulation of macromolecule metabolic process; and regulation of autophagy. Located in cytosol; extracellular region; and nucleus. Part of inflammasome complex. Is expressed in several structures, including alimentary system; brain; heart; hemolymphoid system gland; and urinary system. Orthologous to human PYCARD (PYD and CARD domain containing).
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 17kDa/24kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human, Mouse, Rat
- Sequenz:
- MGRARDAILDALENLSGDELKKFKMKLLTVQLREGYGRIPRGALLQMDAIDLTDKLVSYYLESYGLELTMTVLRDMGLQELAEQLQTTKEESG
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:A24165