JAM-A/CD321 Rabbit polyclonal antibody
Produktgrößen
20 ul
£152,00
A23909-20UL
100 ul
£336,00
A23909-100UL
500 ul
£1258,00
A23909-500UL
1000 ul
£2228,00
A23909-1000UL
Über dieses Produkt
- SKU:
- A23909
- Zusätzliche Namen:
- 9130004G24|ESTM33|JAM|JAM-1|JAM-A|JAM-A/CD321|Jcam|Jcam1|Ly106
- Anwendung:
- ELISA, Western Blot
- Klonalität:
- Polyclonal
- Weitere Details:
- Predicted to enable PDZ domain binding activity; integrin binding activity; and protein homodimerization activity. Involved in intestinal absorption; regulation of cytokine production; and regulation of membrane permeability. Acts upstream of or within cell adhesion and epithelial cell differentiation. Located in bicellular tight junction. Is expressed in several structures, including 4-8 cell stage embryo; alimentary system; respiratory system; sensory organ; and urinary system. Human ortholog(s) of this gene implicated in hypertension. Orthologous to human F11R (F11 receptor).
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 36-41kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human, Mouse, Rat
- Sequenz:
- KGSVYTAQSDVQVPENESIKLTCTYSGFSSPRVEWKFVQGSTTALVCYNSQITAPYADRVTFSSSGITFSSVTRKDNGEYTCMVSEEGGQNYGEVSIHLTVLVPPSKPTISVPSSVTIGNRAVLTCSEHDGSPPSEYSWFKDGISMLTADAKKTRAFMNSSFTIDPKSGDLIFDPVTAFDSGEYYCQAQNGYGTAMRSEAAHMDAVELNVGGIVAA
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:A23909