ABflo[R] 488 Rabbit anti-Mouse CD95/FAS monoclonal antibody
Produktgrößen
10 tests
£ POA
A23810-10TESTS
100 tests
£259,00
A23810-100TESTS
200 tests
£390,00
A23810-200TESTS
500 tests
£592,00
A23810-500TESTS
Über dieses Produkt
- SKU:
- A23810
- Zusätzliche Namen:
- APO1|APT1|CD95|lpr|TNFR6|Tnfrsf6
- Anwendung:
- Flow Cytometry
- Klonalität:
- Monoclonal
- Konjugat:
- ABflo® 488
- Weitere Details:
- CD95, also known as Fas, is a approximately 45 kD type I transmembrane protein in the TNFR superfamily (TNFRSF6). CD95 was expressed in thymus, spleen, liver, heart, lung, ovary and other organs. CD95 binds ligand (FasL) to form a death-inducing signaling complex (DISC) in cells to induce apoptosis. Cd95-induced apoptosis plays an important role in development and in maintaining peripheral tolerance of the immune system.
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 37KDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Mouse
- Sequenz:
- QGTNSISESLKLRRRVRETDKNCSEGLYQGGPFCCQPCQPGKKKVEDCKMNGGTPTCAPCTEGKEYMDKNHYADKCRRCTLCDEEHGLEVETNCTLTQNTKCKCKPDFYCDSPGCEHCVRCASCEHGTLEPCTATSNTNCRKQSPRNR
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- 2-8[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:A23810
