ABflo[R] 594 Rabbit anti-Mouse CD25 monoclonal antibody
Produktgrößen
10 tests
£ POA
A23809-10TESTS
100 tests
£181,00
A23809-100TESTS
200 tests
£283,00
A23809-200TESTS
500 tests
£419,00
A23809-500TESTS
Über dieses Produkt
- SKU:
- A23809
- Zusätzliche Namen:
- CD25|Il2r|Ly-43
- Anwendung:
- Flow Cytometry
- Klonalität:
- Monoclonal
- Konjugat:
- ABflo® 647
- Weitere Details:
- Enables interleukin-2 binding activity and interleukin-2 receptor activity. Acts upstream of or within several processes, including Notch signaling pathway; activation-induced cell death of T cells; and regulation of T cell proliferation. Located in external side of plasma membrane. Is expressed in bone marrow. Used to study Sjogren's syndrome and inflammatory bowel disease. Human ortholog(s) of this gene implicated in immunodeficiency 41; lymphopenia; multiple sclerosis; type 1 diabetes mellitus; and type 1 diabetes mellitus 10. Orthologous to human IL2RA (interleukin 2 receptor subunit alpha).
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- Refer to figures
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Mouse
- Sequenz:
- ELCLYDPPEVPNATFKALSYKNGTILNCECKRGFRRLKELVYMRCLGNSWSSNCQCTSNSHDKSRKQVTAQLEHQKEQQTTTDMQKPTQSMHQENLTGHCREPPPWKHEDSKRIYHFVEGQSVHYECIPGYKALQRGPAISICKMKCGKTGWTQPQLTCVDEREHHRFLASEESQGSRNSSPESETSCPITTTDFPQPTETTAMTETFVLTMEYK
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- 2-8[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:A23809