ABflo[R] 488 Rabbit anti-Mouse CD2 monoclonal antibody
Produktgrößen
10 tests
£ POA
A23704-10TESTS
100 tests
£181,00
A23704-100TESTS
200 tests
£283,00
A23704-200TESTS
500 tests
£419,00
A23704-500TESTS
Über dieses Produkt
- SKU:
- A23704
- Zusätzliche Namen:
- LFA-2|Ly-37|Ly37
- Anwendung:
- Flow Cytometry
- Klonalität:
- Monoclonal
- Konjugat:
- ABflo® 488
- Weitere Details:
- Enables identical protein binding activity. Predicted to be involved in T cell activation; heterotypic cell-cell adhesion; and positive regulation of cytokine production. Located in several cellular components, including cell-cell junction; cytoplasmic side of plasma membrane; and external side of plasma membrane. Is anchored component of plasma membrane. Is expressed in several structures, including alimentary system; central nervous system; genitourinary system; hemolymphoid system gland; and liver and biliary system. Orthologous to human CD2 (CD2 molecule).
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 38kda
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Mouse
- Sequenz:
- RDNETIWGVLGHGITLNIPNFQMTDDIDEVRWVRRGTLVAEFKRKKPPFLISETYEVLANGSLKIKKPMMRNDSGTYNVMVYGTNGMTRLEKDLDVRILERVSKPMIHWECPNTTLTCAVLQGTDFELKLYQGETLLNSLPQKNMSYQWTNLNAPFKCEAINPVSKESKMEVVNCPEKGLS
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- 2-8[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:A23704
