IL22 Rabbit polyclonal antibody
Produktgrößen
20 ul
£152,00
A23665-20UL
100 ul
£336,00
A23665-100UL
500 ul
£1258,00
A23665-500UL
1000 ul
£2228,00
A23665-1000UL
Über dieses Produkt
- SKU:
- A23665
- Zusätzliche Namen:
- If2b1|IL-22|IL-22a|IL22|Iltif|ILTIFa
- Anwendung:
- ELISA, Western Blot
- Klonalität:
- Polyclonal
- Weitere Details:
- Predicted to enable cytokine activity. Acts upstream of or within several processes, including negative regulation of inflammatory response; reactive oxygen species metabolic process; and regulation of tyrosine phosphorylation of STAT protein. Predicted to be located in extracellular space. Is expressed in retina and skin. Used to study liposarcoma. Human ortholog(s) of this gene implicated in asthma. Orthologous to human IL22 (interleukin 22).
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 16kDa/18kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human, Mouse
- Sequenz:
- LPVNTRCKLEVSNFQQPYIVNRTFMLAKEASLADNNTDVRLIGEKLFRGVSAKDQCYLMKQVLNFTLEDVLLPQSDRFQPYMQEVVPFLTKLSNQLSSCHISGDDQNIQKNVRRLKETVKKLGESGEIKAIGELDLLFMSLRNACV
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:A23665