CD90.1 Rabbit polyclonal antibody
Produktgrößen
20 ul
£152,00
A23659-20UL
100 ul
£336,00
A23659-100UL
500 ul
£1258,00
A23659-500UL
1000 ul
£2228,00
A23659-1000UL
Über dieses Produkt
- SKU:
- A23659
- Zusätzliche Namen:
- CD90|CD90.1|T25|Thy-1|Thy-1.2|Thy1.1|Thy1.2
- Anwendung:
- ELISA, Western Blot
- Klonalität:
- Polyclonal
- Weitere Details:
- This gene encodes a glycoprotein that is anchored to the cell surface of thymocytes, neuronal and other cells through a glycosyl-phosphatidylinositol moiety. A soluble form of the encoded protein has also been detected in serum and cerebrospinal fluid. The encoded protein undergoes further processing to generate the mature protein which mediates cell-cell interactions to trigger downstream signaling pathways.
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 18-22kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Mouse
- Sequenz:
- QKVTSLTACLVNQNLRLDCRHENNTKDNSIQHEFSLTREKRKHVLSGTLGIPEHTYRSRVTLSNQPYIKVLTLANFTTKDEGDYFCELQVSGANPMSSNKS
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:A23659