CD119 Rabbit polyclonal antibody
Produktgrößen
20 ul
£152,00
A23652-20UL
100 ul
£336,00
A23652-100UL
500 ul
£1258,00
A23652-500UL
1000 ul
£2228,00
A23652-1000UL
Über dieses Produkt
- SKU:
- A23652
- Zusätzliche Namen:
- CD119|Ifgr|IFN-gammaR|Ifngr|Nktar
- Anwendung:
- ELISA, Western Blot
- Klonalität:
- Polyclonal
- Weitere Details:
- Predicted to enable cytokine receptor activity. Involved in several processes, including astrocyte activation; negative regulation of amyloid-beta clearance; and positive regulation of macromolecule metabolic process. Acts upstream of or within defense response to virus. Predicted to be located in several cellular components, including dendrite; endoplasmic reticulum; and postsynaptic density. Predicted to be integral component of plasma membrane. Is expressed in several structures, including alimentary system; cerebral cortex; cranium; female reproductive system; and liver. Used to study osteoporosis. Human ortholog(s) of this gene implicated in asthma; hepatitis B; immunodeficiency 27A; immunodeficiency 27B; and tuberculosis. Orthologous to human IFNGR1 (interferon gamma receptor 1).
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 70-95kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Mouse
- Sequenz:
- ALTSTEDPEPPSVPVPTNVLIKSYNLNPVVCWEYQNMSQTPIFTVQVKVYSGSWTDSCTNISDHCCNIYEQIMYPDVSAWARVKAKVGQKESDYARSKEFLMCLKGKVGPPGLEIRRKKEEQLSVLVFHPEVVVNGESQGTMFGDGSTCYTFDYTVYVEHNRSGEILHTKHTVEKEECNETLCELNISVSTLDSRYCISVDGISSFWQVRTEKSKDVCIPPFHDD
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:A23652