Hmox1 Rabbit polyclonal antibody
Produktgrößen
20 ul
£152,00
A23650-20UL
100 ul
£336,00
A23650-100UL
500 ul
£1258,00
A23650-500UL
1000 ul
£2228,00
A23650-1000UL
Über dieses Produkt
- SKU:
- A23650
- Zusätzliche Namen:
- D8Wsu38e|Hemox|Hmox|Hmox1|HO-1|HO1|Hsp32
- Anwendung:
- ELISA, IHC-Paraffin, Immunofluorescence, Western Blot
- Klonalität:
- Polyclonal
- Weitere Details:
- Predicted to enable several functions, including heme binding activity; heme oxygenase (decyclizing) activity; and protein homodimerization activity. Acts upstream of or within several processes, including cellular response to cisplatin; cellular response to metal ion; and regulation of macroautophagy. Located in nucleus. Is expressed in several structures, including alimentary system; central nervous system; early conceptus; genitourinary system; and sensory organ. Used to study hemochromatosis and malaria. Human ortholog(s) of this gene implicated in several diseases, including artery disease (multiple); cerebrovascular disease (multiple); factor VIII deficiency; lung disease (multiple); and sickle cell anemia. Orthologous to human HMOX1 (heme oxygenase 1).
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 30kDa/35kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Mouse, Rat
- Sequenz:
- ERPQPDSMPQDLSEALKEATKEVHIQAENAEFMKNFQKGQVSREGFKLVMASLYHIYTALEEEIERNKQNPVYAPLYFPEELHRRAALEQDMAFWYGPHWQEIIPCTPATQHYVKRLHEVGRTHPELLVAHAYTRYLGDLSGGQVLKKIAQKAMALPSSGEGLAFFTFPNIDSPTKFKQLYRARMNTLEMTPEVKHRVTEEAKTAFLLNIELFEELQVMLTEEHKDQSPSQMASLRQRPASLVQDTAPAETPRGKPQISTSSSQT
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:A23650