Uhrf2 Rabbit polyclonal antibody
Produktgrößen
20 ul
£152,00
A2344-20UL
100 ul
£336,00
A2344-100UL
500 ul
£1258,00
A2344-500UL
1000 ul
£2228,00
A2344-1000UL
Über dieses Produkt
- SKU:
- A2344
- Zusätzliche Namen:
- 2310065A22Rik|D130071B19Rik|Nirf|Uhrf2
- Anwendung:
- ELISA, Western Blot
- Klonalität:
- Polyclonal
- Weitere Details:
- Enables histone binding activity. Predicted to be involved in several processes, including maintenance of DNA methylation; protein autoubiquitination; and regulation of cell cycle. Located in heterochromatin and nucleus. Is expressed in several structures, including central nervous system; ear; early conceptus; female reproductive system; and urinary system. Orthologous to human UHRF2 (ubiquitin like with PHD and ring finger domains 2).
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 95kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human, Mouse, Rat
- Sequenz:
- DSSLPSTSKQNDAQVKPSSHNPPKVKKTARGGSSSQPSTSARTCLIDPGFGLYKVNELVDARDVGLGAWFEAHIHSVTRASDGHSRGKTPLKNGSSYKRTNGNVNHNSKENTNKLDNVPSTSNSDSVAADEDVIYHIEYDEYPESGILEMNVKDLRPRARTILKWNELNVGDVVMVNYNVENPGKRGFWYDAEITTLKTISRTKKEVRVKVFLGGSEGTLNDCRVMSVDEIFKIEKPGAHPISFADGKFLRKNDPECDLCGGDPDKTCHMCSCHKCGEKRDPNM
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:A2344