TNFA Alpha Rabbit polyclonal antibody
Produktgrößen
20 ul
£152,00
A23264-20UL
100 ul
£336,00
A23264-100UL
500 ul
£1258,00
A23264-500UL
1000 ul
£2228,00
A23264-1000UL
Über dieses Produkt
- SKU:
- A23264
- Zusätzliche Namen:
- RATTNF|TNF-alpha|Tnfa|TNFA Alpha
- Anwendung:
- ELISA, Western Blot
- Klonalität:
- Polyclonal
- Weitere Details:
- Enables tumor necrosis factor receptor binding activity. Involved in several processes, including positive regulation of cell communication; positive regulation of macromolecule metabolic process; and positive regulation of neuron death. Located in several cellular components, including external side of plasma membrane; extracellular space; and neuronal cell body. Used to study several diseases, including cerebrovascular disease (multiple); liver disease (multiple); peptic esophagitis; perinatal necrotizing enterocolitis; and periventricular leukomalacia. Biomarker of several diseases, including brain disease (multiple); congestive heart failure (multiple); inflammatory bowel disease (multiple); lung disease (multiple); and non-alcoholic fatty liver disease (multiple). Human ortholog(s) of this gene implicated in several diseases, including artery disease (multiple); autoimmune disease (multiple); eye disease (multiple); lung disease (multiple); and skin disease (multiple). Orthologous to human TNF (tumor necrosis factor).
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 17kDa/26kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human, Mouse, Other Species, Rat
- Sequenz:
- LRSSSQNSSDKPVAHVVANHQAEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLIYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVSLLSAIKSPCPKDTPEGAELKPWYEPMYLGGVFQLEKGDLLSAEVNLPKYLDITESGQVYFGVIAL
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:A23264