CD107b Rabbit polyclonal antibody
Produktgrößen
20 ul
£152,00
A23260-20UL
100 ul
£336,00
A23260-100UL
500 ul
£1258,00
A23260-500UL
1000 ul
£2228,00
A23260-1000UL
Über dieses Produkt
- SKU:
- A23260
- Zusätzliche Namen:
- CD107b|Lamp II|Lamp-2|Lamp-2a|Lamp-2b|Lamp-2c|LGP-B|Mac3
- Anwendung:
- ELISA, Western Blot
- Klonalität:
- Polyclonal
- Weitere Details:
- Enables protein domain specific binding activity. Involved in several processes, including autophagosome maturation; protein stabilization; and protein targeting to lysosome involved in chaperone-mediated autophagy. Acts upstream of or within muscle cell cellular homeostasis. Located in late endosome membrane; lysosomal membrane; and phagocytic vesicle membrane. Is integral component of autophagosome membrane. Is expressed in central nervous system; egg cylinder; lung; and retina. Used to study Danon disease. Human ortholog(s) of this gene implicated in Danon disease and hypertrophic cardiomyopathy. Orthologous to human LAMP2 (lysosomal associated membrane protein 2).
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 102kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Mouse
- Sequenz:
- LIVNLTDSKGTCLYAEWEMNFTITYETTNQTNKTITIAVPDKATHDGSSCGDDRNSAKIMIQFGFAVSWAVNFTKEASHYSIHDIVLSYNTSDSTVFPGAVAKGVHTVKNPENFKVPLDVIFKCNSVLTYNLTPVVQKYWGIHLQAFVQNGTVSKNEQVCEEDQ
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:A23260