[KD Validated] BUB1 Rabbit monoclonal antibody
Produktgrößen
5 ul
£ POA
A23198-5UL
20 ul
£164,00
A23198-20UL
100 ul
£342,00
A23198-100UL
500 ul
£1532,00
A23198-500UL
1000 ul
£2704,00
A23198-1000UL
Über dieses Produkt
- SKU:
- A23198
- Zusätzliche Namen:
- [KD Validated] BUB1|BUB1A|BUB1L|hBUB1|MCPH30
- Anwendung:
- ELISA, Western Blot
- Klonalität:
- Monoclonal
- Weitere Details:
- This gene encodes a serine/threonine-protein kinase that play a central role in mitosis. The encoded protein functions in part by phosphorylating members of the mitotic checkpoint complex and activating the spindle checkpoint. This protein also plays a role in inhibiting the activation of the anaphase promoting complex/cyclosome. This protein may also function in the DNA damage response. Mutations in this gene have been associated with aneuploidy and several forms of cancer. Alternate splicing results in multiple transcript variants.
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 130 kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human
- Sequenz:
- MDTPENVLQMLEAHMQSYKGNDPLGEWERYIQWVEENFPENKEYLITLLEHLMKEFLDKKKYHNDPRFISYCLKFAEYNSDLHQFFEFLYNHGIGTLSSPLYIAWAGHLEAQGELQHASAVLQRGIQNQAEPREFLQQQYRLFQTRLTET
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:A23198