CD103 Rabbit polyclonal antibody
Produktgrößen
20 ul
£152,00
A23053-20UL
100 ul
£336,00
A23053-100UL
500 ul
£1258,00
A23053-500UL
1000 ul
£2228,00
A23053-1000UL
Über dieses Produkt
- SKU:
- A23053
- Zusätzliche Namen:
- A530055J10|alpha-E1|alpha-M290|aM290|CD103
- Anwendung:
- ELISA, Western Blot
- Klonalität:
- Polyclonal
- Weitere Details:
- Predicted to enable metal ion binding activity. Predicted to act upstream of or within cell adhesion and integrin-mediated signaling pathway. Located in external side of plasma membrane. Is expressed in several structures, including alimentary system; genitourinary system; lymph node; nasal septum; and nucleus pulposus. Orthologous to human ITGAE (integrin subunit alpha E).
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 150kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Mouse
- Sequenz:
- EDGTEIAIVLDGSGSIEPSDFQKAKNFISTMMRNFYEKCFECNFALVQYGAVIQTEFDLQESRDINASLAKVQSIVQVKEVTKTASAMQHVLDNIFIPSRGSRKKALKVMVVLTDGDIFGDPLNLTTVINSPKMQGVVRFAIGVGDAFKNNNTYRELKLIASDPKEAHTFKVTNYSALDGLLSKLQQHIVHMEGT
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:A23053