IL-1 alpha Rabbit monoclonal antibody
Produktgrößen
5 ul
£ POA
A22766-5UL
20 ul
£164,00
A22766-20UL
100 ul
£342,00
A22766-100UL
500 ul
£1532,00
A22766-500UL
1000 ul
£2704,00
A22766-1000UL
Über dieses Produkt
- SKU:
- A22766
- Zusätzliche Namen:
- IL-1 alpha|Il-1a
- Anwendung:
- ELISA, Immunocytochemistry, Immunofluorescence, Western Blot
- Klonalität:
- Monoclonal
- Weitere Details:
- Enables cytokine activity and interleukin-1 receptor binding activity. Involved in positive regulation of angiogenesis and positive regulation of vascular endothelial growth factor production. Acts upstream of or within several processes, including cell surface receptor signaling pathway; connective tissue replacement involved in inflammatory response wound healing; and positive regulation of cytokine production. Located in cytoplasm and extracellular space. Is expressed in several structures, including alimentary system; brain; hemolymphoid system gland; reproductive system; and respiratory system. Human ortholog(s) of this gene implicated in several diseases, including Fabry disease; Schnitzler syndrome; autoimmune disease (multiple); hematologic cancer (multiple); and lung disease (multiple). Orthologous to human IL1A (interleukin 1 alpha).
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 20-25 kDa/31 kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Mouse
- Sequenz:
- SAPYTYQSDLRYKLMKLVRQKFVMNDSLNQTIYQDVDKHYLSTTWLNDLQQEVKFDMYAYSSGGDDSKYPVTLKISDSQLFVSAQGEDQPVLLKELPETPKLITGSETDLIFFWKSINSKNYFTSAAYPELFIATKEQSRVHLARGLPSMTDFQIS
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:A22766