Siglec1 Rabbit polyclonal antibody
Produktgrößen
20 ul
£152,00
A22677-20UL
100 ug
£336,00
A22677-100UG
500 ul
£1258,00
A22677-500UL
1000 ul
£2228,00
A22677-1000UL
Über dieses Produkt
- SKU:
- A22677
- Zusätzliche Namen:
- Cd169|Siglec-1|Siglec1|Sn
- Anwendung:
- ELISA, Western Blot
- Klonalität:
- Polyclonal
- Weitere Details:
- Predicted to enable virion binding activity. Acts upstream of or within positive regulation of T cell apoptotic process and positive regulation of extrinsic apoptotic signaling pathway. Predicted to be located in extracellular region and membrane. Predicted to be integral component of membrane. Predicted to be active in early endosome; late endosome; and plasma membrane. Is expressed in immune system; reproductive system; and skin. Orthologous to human SIGLEC1 (sialic acid binding Ig like lectin 1).
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 200kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Rat
- Sequenz:
- TWGVSSPKNVQGLSGSCLLIPCIFSYPADVPVSNGITAIWYYDYSGKRQVVIHSGDPKLVDKRFRGRAELMGNMDHKVCNLLLKDLKPEDSGTYNFRFEISDSNRWLDVKGTTVTVTTD
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:A22677