ABflo[R] 488 Rabbit anti-Dog CD27 monoclonal antibody
Produktgrößen
10 tests
£ POA
A22575-10TESTS
100 tests
£324,00
A22575-100TESTS
200 tests
£509,00
A22575-200TESTS
500 tests
£782,00
A22575-500TESTS
Über dieses Produkt
- SKU:
- A22575
- Zusätzliche Namen:
- S152|S152. LPFS2|T14|TNFRSF7|Tp55
- Anwendung:
- Flow Cytometry
- Klonalität:
- Monoclonal
- Konjugat:
- ABflo® 488
- Weitere Details:
- The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is required for generation and long-term maintenance of T cell immunity. It binds to ligand CD70, and plays a key role in regulating B-cell activation and immunoglobulin synthesis. This receptor transduces signals that lead to the activation of NF-kappaB and MAPK8/JNK. Adaptor proteins TRAF2 and TRAF5 have been shown to mediate the signaling process of this receptor. CD27-binding protein (SIVA), a proapoptotic protein, can bind to this receptor and is thought to play an important role in the apoptosis induced by this receptor.
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 31kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Canine
- Sequenz:
- ATPAPKRCPEKHYQVQGERCCQMCKPGTFLVKDCERHGEAAQCDPCIPGASFSPDHHARRHCESCRHCNSGLLIRNCTLTANAECDCPKGWKCRDKQCTECDPPSNPLLIPHPSPARGPHLQPTHLPYAKIKFQATLCPVTGIVRLSPQSPPSPKMQETSTVRQVQTLADFRWLPAPALSTHWPPQRSLCSSDCIR
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- 2-8[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:A22575

