MST1 Rabbit polyclonal antibody
Produktgrößen
20 ul
£152,00
A21842-20UL
100 ul
£336,00
A21842-100UL
500 ul
£1258,00
A21842-500UL
1000 ul
£2228,00
A21842-1000UL
Über dieses Produkt
- SKU:
- A21842
- Zusätzliche Namen:
- KRS2|MST1|STK4|YSK3
- Anwendung:
- ELISA, IHC-Paraffin, Immunocytochemistry, Immunofluorescence, Western Blot
- Klonalität:
- Polyclonal
- Weitere Details:
- The protein encoded by this gene is a cytoplasmic kinase that is structurally similar to the yeast Ste20p kinase, which acts upstream of the stress-induced mitogen-activated protein kinase cascade. The encoded protein can phosphorylate myelin basic protein and undergoes autophosphorylation. A caspase-cleaved fragment of the encoded protein has been shown to be capable of phosphorylating histone H2B. The particular phosphorylation catalyzed by this protein has been correlated with apoptosis, and it's possible that this protein induces the chromatin condensation observed in this process.
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 56kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human, Mouse, Rat
- Sequenz:
- KRQESQQREVDQDDEENSEEDEMDSGTMVRAVGDEMGTVRVASTMTDGANTMIEHDDTLPSQLGTMVINAEDEEEEGTMKRRDETMQPAKPSFLEYFEQKEKENQINSFGKSVPGPLKNSSDWKIPQDGDYEFLKSWTVEDLQKRLLALDPMMEQEIEEIRQKYQSKRQPILDAIEAKKRRQQNF
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:A21842