IL1RN Rabbit polyclonal antibody
Produktgrößen
20 ul
£152,00
A21089-20UL
100 ul
£336,00
A21089-100UL
500 ul
£1258,00
A21089-500UL
1000 ul
£2228,00
A21089-1000UL
Über dieses Produkt
- SKU:
- A21089
- Zusätzliche Namen:
- F630041P17Rik|IL-1ra|IL1RN
- Anwendung:
- ELISA, Immunocytochemistry, Immunofluorescence, Western Blot
- Klonalität:
- Polyclonal
- Weitere Details:
- Predicted to enable cytokine receptor binding activity. Acts upstream of or within insulin secretion and lipid metabolic process. Located in extracellular region and vesicle. Human ortholog(s) of this gene implicated in several diseases, including autoimmune disease (multiple); eye disease (multiple); kidney failure (multiple); lung disease (multiple); and vascular disease (multiple). Orthologous to human IL1RN (interleukin 1 receptor antagonist).
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 18kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human, Mouse
- Sequenz:
- RPSGKRPCKMQAFRIWDTNQKTFYLRNNQLIAGYLQGPNIKLEEKIDMVPIDLHSVFLGIHGGKLCLSCAKSGDDIKLQLEEVNITDLSKNKEEDKRFTFIRSEKGPTTSFESAACPGWFLCTTLEADRPVSLTNTPEEPLIVTKFYFQEDQ
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:A21089