P2Y12 Rabbit monoclonal antibody
Produktgrößen
5 ul
£ POA
A20864-5UL
20 ul
£164,00
A20864-20UL
100 ul
£342,00
A20864-100UL
500 ul
£1532,00
A20864-500UL
1000 ul
£2704,00
A20864-1000UL
Über dieses Produkt
- SKU:
- A20864
- Zusätzliche Namen:
- 2900079B22Rik|4921504D23Rik|P2Y12
- Anwendung:
- ELISA, Immunofluorescence, Western Blot
- Klonalität:
- Monoclonal
- Weitere Details:
- Enables G protein-coupled ADP receptor activity and G protein-coupled adenosine receptor activity. Involved in several processes, including cellular response to ATP; regulation of microglial cell migration; and substrate-dependent cell migration, cell extension. Acts upstream of or within several processes, including adenylate cyclase-modulating G protein-coupled receptor signaling pathway; platelet activation; and positive regulation of ion transport. Located in cell body membrane and cell projection membrane. Is expressed in central nervous system and cerebral cortex. Used to study platelet-type bleeding disorder 8. Human ortholog(s) of this gene implicated in asthma; cerebrovascular disease; peripheral artery disease; platelet-type bleeding disorder 8; and type 2 diabetes mellitus. Orthologous to human P2RY12 (purinergic receptor P2Y12).
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 55kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Mouse, Rat
- Sequenz:
- FLGLITIDRYLKTTRPFKTSSPSNLLGAKILSVVIWAFMFLISLPNMILTNRRPKDKDVTKCSFLKSEFGLVWHEIVNYICQVIFWINFLIVIVCYSLITKELYRSYVRTRGSAKVPKKKVNVKVFIIIAVFFICFVPFHFARIPYTLSQTRAVFDCSAENTLFYVKESTLWLTSLNACLDPFIYFFLCKSFRNSLTSMLRCSNSTSTSGTNKKKGQEGGEPSEETPM
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:A20864