Timm22 Rabbit polyclonal antibody
Produktgrößen
20 ul
£152,00
A20813-20UL
100 ul
£336,00
A20813-100UL
500 ul
£1258,00
A20813-500UL
1000 ul
£2228,00
A20813-1000UL
Über dieses Produkt
- SKU:
- A20813
- Zusätzliche Namen:
- Tim22|Timm22
- Anwendung:
- ELISA, Immunoprecipitation, Western Blot
- Klonalität:
- Polyclonal
- Weitere Details:
- Predicted to enable mitochondrion targeting sequence binding activity and protein transmembrane transporter activity. Predicted to be involved in protein insertion into mitochondrial inner membrane. Predicted to act upstream of or within protein transport. Located in mitochondrion. Is expressed in several structures, including alimentary system; brain; cardiovascular system; egg cylinder; and genitourinary system. Human ortholog(s) of this gene implicated in combined oxidative phosphorylation deficiency 43. Orthologous to human TIMM22 (translocase of inner mitochondrial membrane 22).
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 20kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human, Mouse, Rat
- Sequenz:
- AEAPLQYSLLLQYLVGDKRQPRLLEPGSLGGIPSPAKSEEQKMIERAMESCAFKAVLACVGGFVLGGAFGIFTAGIDTNVGFDPKDPYRTPTAKEVLKDMGQR
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:A20813