Timm29 Rabbit polyclonal antibody
Produktgrößen
20 ul
£152,00
A20812-20UL
100 ul
£336,00
A20812-100UL
500 ul
£1258,00
A20812-500UL
1000 ul
£2228,00
A20812-1000UL
Über dieses Produkt
- SKU:
- A20812
- Zusätzliche Namen:
- 1810026J23Rik|TIM29|Timm29
- Anwendung:
- ELISA, Immunoprecipitation, Western Blot
- Klonalität:
- Polyclonal
- Weitere Details:
- Predicted to enable protein transporter activity. Predicted to be involved in protein insertion into mitochondrial inner membrane. Predicted to act upstream of or within protein transport. Predicted to be located in mitochondrial inner membrane and mitochondrial intermembrane space. Predicted to be part of TIM22 mitochondrial import inner membrane insertion complex. Orthologous to human TIMM29 (translocase of inner mitochondrial membrane 29).
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 29kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human, Mouse
- Sequenz:
- YLQPRWVDFPGRILDVGFVGRWWILQNRMHDCDINDDEFLHLPAHLRVVAPHQLHSEANERLFEEKYKPIILTDDQVDQALWEEQVLQKERKDRLALSEADSLVQSDVSR
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:A20812