HCoV-HKU1 Nucleoprotein Rabbit polyclonal antibody
Produktgrößen
20 ul
£152,00
A20612-20UL
100 ul
£336,00
A20612-100UL
500 ul
£1258,00
A20612-500UL
1000 ul
£2228,00
A20612-1000UL
Über dieses Produkt
- SKU:
- A20612
- Anwendung:
- ELISA, Western Blot
- Klonalität:
- Polyclonal
- Weitere Details:
- Packages the positive strand viral genome RNA into a helical ribonucleocapsid (RNP and plays a fundamental role during virion assembly through its interactions with the viral genome and membrane protein M. Plays an important role in enhancing the efficiency of subgenomic viral RNA transcription as well as viral replication.
- Formulierung:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotyp:
- IgG
- Molekulargewicht:
- 50-60kDa
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Virus
- Sequenz:
- WYRHSRRSFKTADGQQKQLLPRWYFYYLGTGPYANASYGESLEGVFWVANHQADTSTPSDVSSRDPTTQEAIPTRFPPGTILPQGYYVEGSGRSASNSRPG
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:A20612